PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00501.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 412aa    MW: 45179.9 Da    PI: 9.2762
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00501.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.4e-09160206347
                                   SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 
                                    WTteE + + +a ++   +   +W++ a++++ ++t  ++ ++++++
  Zmw_sc00501.1.g00160.1.am.mk 160 TWTTEENKVFEKALALIDRNapdRWEKMASMLP-RKTVADVMNHYNDL 206
                                   7*****************99*************.***********986 PP

2Myb_DNA-binding41.14.2e-13267311347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +WT++E++l++++ +++G g W+ Ia  + ++Rt+ q+ s+ qky
  Zmw_sc00501.1.g00160.1.am.mk 267 PWTEDEHKLFLQGLRKYGRGYWRNIALNFVTTRTPTQVASHAQKY 311
                                   8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.521156210IPR017884SANT domain
SMARTSM007172.2E-7157209IPR001005SANT/Myb domain
SuperFamilySSF466893.73E-10159213IPR009057Homeodomain-like
CDDcd001672.24E-6160206No hitNo description
Gene3DG3DSA:1.10.10.604.1E-4160206IPR009057Homeodomain-like
PfamPF002492.9E-6160206IPR001005SANT/Myb domain
PROSITE profilePS5129418.736260316IPR017930Myb domain
SuperFamilySSF466894.02E-16262317IPR009057Homeodomain-like
SMARTSM007171.7E-10264314IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-10264310IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-16264314IPR006447Myb domain, plants
CDDcd001672.11E-9267312No hitNo description
PfamPF002492.4E-11267311IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDVPAAASVE RSVPEYGRRV DPLVAAATVQ ERALSRSLGG ELRLERPLSP PRRQNPITSI  60
HSRAFSSRPA TVELEYNSGH LGIHPELDTS LLYSTPTPHS ASLFSLFRLL RHQPAQVPVA  120
KMMAETWTQM LLPTTGLWFS GQSCCPWPDR HAGGGIGGDT WTTEENKVFE KALALIDRNA  180
PDRWEKMASM LPRKTVADVM NHYNDLENDV GFIEAGLVSF PHYSSSPSPP SSGFTLDHWD  240
GSDGGFRRGC GLKRGRGPGQ ERRKGVPWTE DEHKLFLQGL RKYGRGYWRN IALNFVTTRT  300
PTQVASHAQK YFIRLQSGGK DKRRPSIHDT TTANLSLPND DHGNISPSPS SALNTASNPT  360
GGADQFGALT DVKPFIPPFP GVAHPYTNVK LGPKSSLVSG LGFDDSVLLQ IL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-13158226876RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970612.11e-133PREDICTED: transcription factor DIVARICATA
TrEMBLK3XKK01e-133K3XKK0_SETIT; Uncharacterized protein
STRINGSi002423m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796